PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0059s0348.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 394aa    MW: 42027.5 Da    PI: 5.3815
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0059s0348.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.6e-33186243158
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                          ldDgy+WrKYGqK vk+s+fprsYYrCts++C v+k+vers+ed  +v++tYeg+H+h
  Kaladp0059s0348.1.p 186 LDDGYRWRKYGQKAVKNSPFPRSYYRCTSPSCGVQKRVERSSEDSAIVVTTYEGQHTH 243
                          59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-33172245IPR003657WRKY domain
SuperFamilySSF1182902.48E-28178244IPR003657WRKY domain
PROSITE profilePS5081131.077181246IPR003657WRKY domain
SMARTSM007745.2E-39186245IPR003657WRKY domain
PfamPF031064.1E-26187243IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MDGAEDQTAT IDSLLMMSPS FPDQIPASSF SLSGLFDMPP LAASAAPPSA SYSYDIDKSG  60
EGSFLGFSDL LGFQDYCYGA SLFDLIQTSP PLQAVTTTAP SPASTIPETS EVLNGPMTPN  120
SSSNEAAAAA NEEQSEESQG VNGGNTEQED QDRDKTKKQL RPKKKNQKKE MEPRFAFMTK  180
SEIDHLDDGY RWRKYGQKAV KNSPFPRSYY RCTSPSCGVQ KRVERSSEDS AIVVTTYEGQ  240
HTHLSPVMAR GSGITGSLLH HHLDSISSSS CSVQLGVSSL APPPSFPTPS PSSFLNNNAT  300
ANMVSSLSSF INNNPSPPSN HASPSLGRNP FFKERRFCPS PPAAAGHHPP LTSQHITTAP  360
APATAAAAGS SSCLMRDDGL LQDIIMRSDP KEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-261792461077Probable WRKY transcription factor 4
2lex_A3e-261792461077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD9ZJG12e-71D9ZJG1_MALDO; WRKY domain class transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-40WRKY DNA-binding protein 23